PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g08550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 280aa    MW: 31697.2 Da    PI: 6.1043
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g08550genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.2e-1878131356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa+ k
  CA02g08550  78 KKRRLNMEQVKALERSFEIGNKLEPERKMQLARALGLKPRQIAIWFQNRRARCK 131
                 456899**********************************************99 PP

2HD-ZIP_I/II129.11.8e-4177168192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl+ eqvk+LE+sFe  +kLeperK++lar+Lgl+prq+a+WFqnrRAR ktkqlEkdye Lkr++d+lk++n++L++++++L++el 
   CA02g08550  77 EKKRRLNMEQVKALERSFEIGNKLEPERKMQLARALGLKPRQIAIWFQNRRARCKTKQLEKDYEILKRQCDKLKSDNDALKTQNKQLHSELL 168
                  69**************************************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.07E-1874135IPR009057Homeodomain-like
SMARTSM003891.9E-1876137IPR001356Homeobox domain
PROSITE profilePS5007116.16377133IPR001356Homeobox domain
PfamPF000464.8E-1578131IPR001356Homeobox domain
CDDcd000863.74E-1678134No hitNo description
Gene3DG3DSA:1.10.10.607.2E-1980140IPR009057Homeodomain-like
PRINTSPR000311.2E-5104113IPR000047Helix-turn-helix motif
PROSITE patternPS000270108131IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5113129IPR000047Helix-turn-helix motif
CDDcd146860.00486124167No hitNo description
PfamPF021833.8E-15133173IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MLFSKTGTMA FVPGAPEEND LPPSFPGVFP PPCAPHQEFQ GISSVLMRRA MSFDHQDSRA  60
DDIDMSDDDG SSQLLGEKKR RLNMEQVKAL ERSFEIGNKL EPERKMQLAR ALGLKPRQIA  120
IWFQNRRARC KTKQLEKDYE ILKRQCDKLK SDNDALKTQN KQLHSELLTL SNRESAGGGT  180
TILFNLNKEN EGSNWNNGSG DENSTIIDVN LGTTTRTSST NSPHNNNNNN NHDHVFPTSA  240
NYKIEEQTHV PEEGYCNLFN NVVEDQTNYW PLPVQQHFY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125133RRARCKTKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-154HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016561920.11e-172PREDICTED: homeobox-leucine zipper protein HAT7-like
TrEMBLK4B7731e-151K4B773_SOLLC; Uncharacterized protein
STRINGSolyc02g067410.1.11e-151(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8482498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.12e-48HD-ZIP family protein